PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G126646_P01
Common NameHB83, HDZIV13_OCL13, ZEAMMB73_541243, Zm.38765
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 698aa    MW: 76174 Da    PI: 6.6327
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G126646_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-201873156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  GRMZM2G126646_P01 18 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 73
                       678899***********************************************998 PP

2START1632.2e-512104342206
                        HHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
              START   2 laeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        +a +a++el+++a+a+e +Wvk    e +n d++ + f++ ++        ++e +r+sg+v+m ++ lv  ++d++ +W+e ++    ka 
  GRMZM2G126646_P01 210 MATRAMDELIRMAQAGEHLWVKAGgrEVLNVDTYDSVFAKPGAasfrgpdVHVEGSRDSGLVFMSAVGLVDMFMDSS-KWTEFFPaivsKAR 300
                        5789******************999955555555555544444566***99**************************.************** PP

                        EEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  81 tlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvt 165
                        t++v+ +g     + l+lm+ el ++sp+vp R+f f+Ry+rq ++g w+i+d+Svd +q+     ++  R+ +lpSg+li ++++g skvt
  GRMZM2G126646_P01 301 TVDVLVNGmagrsESLVLMYEELHVMSPVVPtREFCFLRYCRQIERGLWAIADISVDLQQHDARfGAPPSRSCRLPSGCLIADMADGSSKVT 392
                        **************************************************************99*99999********************** PP

                        EEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        wveh++ ++r+p h l+r l+ sg+a+ga +w+a+lqr ce+
  GRMZM2G126646_P01 393 WVEHMEIEDRVPiHLLYRDLILSGAAFGAHRWLAALQRACER 434
                        ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-20775IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-221381IPR009057Homeodomain-like
PROSITE profilePS5007118.0581575IPR001356Homeobox domain
SMARTSM003891.4E-191679IPR001356Homeobox domain
CDDcd000861.22E-191776No hitNo description
PfamPF000463.0E-181873IPR001356Homeobox domain
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PROSITE profilePS5084846.558200437IPR002913START domain
SuperFamilySSF559614.81E-32201435No hitNo description
CDDcd088756.32E-106204433No hitNo description
SMARTSM002343.0E-40209434IPR002913START domain
PfamPF018524.4E-44210434IPR002913START domain
Gene3DG3DSA:3.30.530.207.2E-6318404IPR023393START-like domain
SuperFamilySSF559612.05E-20454690No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MDFGDDVMDG GSDAQRRKKR YHRHTPRQIQ QLEAMFKECP HPDENQRMQL SRELGLEPRQ  60
IKFWFQNRRT QMKAQHERQD NCFLRAENDK IRCENIAMRE ALRSVICPTC GGPPVADDYF  120
DEQKLRMENA RLKEELDRVS SLTSKYLGRP ITQLPPAQAA LSMSSLDLSV GGLGSPSLDL  180
DLLSGGSSGY PPFHLPMPVS EMERPMMAEM ATRAMDELIR MAQAGEHLWV KAGGREVLNV  240
DTYDSVFAKP GAASFRGPDV HVEGSRDSGL VFMSAVGLVD MFMDSSKWTE FFPAIVSKAR  300
TVDVLVNGMA GRSESLVLMY EELHVMSPVV PTREFCFLRY CRQIERGLWA IADISVDLQQ  360
HDARFGAPPS RSCRLPSGCL IADMADGSSK VTWVEHMEIE DRVPIHLLYR DLILSGAAFG  420
AHRWLAALQR ACERCACLVP AGMPHRDIAV AGVTPEGKRS MMKLSQRMVS SFCASLSASQ  480
LHRWTTLSGP SDVGVRVTVH RSTDPGQPSG VVLSAATSIW LPVPCDRVFA FVRDEHTRSQ  540
WDVLSHGNPV QEVSRIPNGS HPGNCISLLR GLNASQNSML ILQESCTDGT GSLVVYAPID  600
IPAANVVMSG EDPSAIPLLP SGFTILPDGR PGAPSSSSAG GPLVGSPAAA GSLVTVAFQI  660
LVSSLPSSRL NAESVATVNS LISTTVEQIK AALNCASH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.387650.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G126646
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G126646_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142912.20.0uncharacterized protein LOC100275344
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLG2J5S70.0G2J5S7_MAIZE; HB transcription factor
STRINGGRMZM2G126646_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]